Summary report for "ihostdev.com" (monthly stats)

Quick navigation: Traffic summary Adwords keywords & texts Organic keywords Competitors

Title: iHostDev.com - web host automation and billing solutions

Description: A simple web hosting billing control panel for web hosting with the ability to offer free web ... Want to automate your free and paid cpanel sign ups? ...

Description: A simple web hosting billing control panel for web hosting with the ability to offer free web ... Want to automate your free and paid cpanel sign ups? ...

Advertising budget: N/A

This site in Alpha Directory: i ih iho


Approximate SE paid and organic traffic

Traffic Est. Cost
Organic keywords 794.35 $1.62K*
Paid keywords N/A N/A
* — "Est. Cost" for organic traffic means amount of money the site owner would pay for such traffic if he bought it in PPC systems.

Try our new SERPTrends addon

SERPTrends add-on allows one to monitor SERP changes and view SEM parameters for sites while using Google, Yahoo! or BING search engines on the fly. Add-on adds trends and a drop-down box with SEM parameters near each search result.

Learn more about SERP Trends addon »



Organic keywords

  Keyword Cost Equiv. Position     Keyword Traffic Position     Keyword   Position  
1. ihost $353.10  5    1. ipanel 429  2    1. web hosting billing system   2   
2. ipanel $334.73  2    2. ihost 117  5    2. ipanel   2   
3. ihost $289.88  6    3. ihost 96  6    3. hosting automation   2   
4. hosting automation $197.41  2    4. hosting automation 57  2    4. web host billing system   3   
5. billing hosting $113.43  5    5. web hosting billing system 20  2    5. web hosting automation   4   
6. hosting billing $106.00  8    6. billing hosting 16  5    6. billing hosting   5   
7. web hosting billing system $91.80  2    7. hosting billing 14  8    7. webhosting billing system   5   
8. web hosting automation $61.66  4    8. web hosting automation 13  4    8. ihost   5   
9. hosting billing system $35.36  10    9. hosting billing system 10  10    9. ihost   6   
10. web hosting billing $20.54  14    10. web host billing system 3    10. webhost billing system   8   

Competitors for "ihostdev.com"

Ispsystem.com: Web Hosting Control Panel, Web Hosting Automation Software for Virtual ...

22.04.2009. We are glad to present You a test version of our new web hosting software for complex automation of hosting companies business affairs - hosting billing system ...

Keywords: vds vps; vps vds; hosting billing system; isp system; billing hosting;

Paid traffic cost: $29.97

Brainhost.com:

Keywords: shared hosting; web hosting company; free unlimited web hosting; hosting provider; best host web site hosting;

Paid traffic cost: $64.80K

Hostflow.com: Hosting Control Panel to automate your service on shared and dedicated linux and windows servers

Hostflow offers a complete hosting control panel to sell and manage IP based services with modules for orders, billing, marketing, and support for shared and dedicated linux and windows hosting

Keywords: hosting automation software; hosting automation; control panel software; hosting control panel software; hosting automation control;

Paid traffic cost: N/A

Thewhir.com: Web Hosting Reviews, Hosting Directory | WHIR

The Web Host Industry Review is a web hosting directory for consumers and hosting resellers offering web hosting reviews, web hosting news & more.

Keywords: web hosting sales; web hosting news; megaupload search; whir; web hosting reviews;

Paid traffic cost: N/A

Alabanza.com: alabanza.com - Alabanza web hosting automation – Start your own hosting business with complete automation

Alabanza’s web hosting automation suite enables hosts to easily get started and to grow into profitable hosting businesses. Since 1995, hundreds of the industry’s best hosting companies have relied on Alabanza for web hosting automation.

Keywords: alabanza; hosting automation; hosting automation software; web hosting automation; alabansa;

Paid traffic cost: N/A

Ticket.ihostvm.com: Portal - iHost Networks

Keywords: ihost; web easy; webeasy; easy pages; easy page;

Paid traffic cost: N/A

Nevillearchitecture.com: Naomi Neville Architecture & Environmental Consulting

Naomi Neville, AIA Neville Architecture and Environmental Consulting brings smart design to the residential market and commercial projects that engage the community.

Keywords: ihost;

Paid traffic cost: N/A

Idevspot.com: iDevSpot : PHP Scripts

PHP scripts for web hosting, e-commerce, customer support, user authentication, classified systems, digtal products & more.

Keywords: real estate listing software; text ads; business directory software; hosting script; biz directory;

Paid traffic cost: $2.23K

Ipanel.co.il:

Keywords: ipanel;

Paid traffic cost: N/A

Ihostasp.net: DotNetNuke / DNN Hosting - DNN Hosting Since 2004

We are focused to provide affordable, fast, secure, and reliable DotNetNuke DNN hosting service. We take care of our customers and pride our selfs with quality of service we are able to offer.

Keywords: helm reseller; ihost; dot net nuke hosting; hosting dotnetnuke; helm hosting;

Paid traffic cost: $1.68K

Theregister.co.uk: The Register: Sci/Tech News for the World

Keywords: register; google mail; tv shack; nationwide building society; the register;

Paid traffic cost: N/A

Ihost.net: iHost.net - Web Hosting, Domain Name Registration, E-Commerce, DotNetnuke and Free Online Tools

Signup today for a 15 day free trial - No credit card required.

Keywords: ihost; ecommerce domain hosting; web hosting domain name ecommerce web hosting; dot net web hosting; domain name ecommerce web hosting;

Paid traffic cost: N/A

Quick navigation:

Site info

Traffic summary

Adwords keywords & texts

Organic keywords

Competitors

Other top sites:

newjerseyfinancial.com

newjersey.findlinks.com

newjerseyfingerprinting.com

newjerseyfireground.com

newjerseyfirsttimecashadvance.payday2cashloans.com

Recently processed sites:

jeremyharmer.wordpress.com

jeremyharnish.com

jeremy-harper.com

jeremyharper.com.au

jeremyharperdrivingschool.co.uk


Keyword:
Seen on:
Seen URL:
Position:
Clicks per Month:
Keyword avg. CPC:
Monthly Cost Equivalent (avg. cpc * clicks):



Keyword:
Keyword Avg.CPC:
Seen on:
Seen URL: N/A
Page no.:
Ads Block Position:
Ad Position: